DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CLEC1A

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_011518989.1 Gene:CLEC1A / 51267 HGNCID:24355 Length:307 Species:Homo sapiens


Alignment Length:219 Identity:37/219 - (16%)
Similarity:67/219 - (30%) Gaps:67/219 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 QETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKV------------------ 233
            |:|:.::.|......|:|:..|...:...|:.|...:...:|:|.|.                  
Human    83 QDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGGYTRNMVPASASSESLR 147

  Fly   234 -------------------FWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEEL 279
                               .| |:.......||   ||:..|:....||......:..|..||:|
Human   148 QLPHMGESAAAHRCSPCTEQW-KWHGDNCYQFY---KDSKSWEDCKYFCLSENSTMLKINKQEDL 208

  Fly   280 DAISARLDDK---SYWLGINDLQSSNTYVSVASGREVEFLNWNAGEPNHGN-----------EDE 330
            :..:::...:   |||.|:....|...::            |..|.|....           ...
Human   209 EFAASQSYSEFFYSYWTGLLRPDSGKAWL------------WMDGTPFTSELFHIIIDVTSPRSR 261

  Fly   331 NCVELIRSKMNDDPCHRKKHVICQ 354
            :||.::...:....|...|..:|:
Human   262 DCVAILNGMIFSKDCKELKRCVCE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 8/41 (20%)
CLECT 247..354 CDD:153057 22/120 (18%)
CLEC1AXP_011518989.1 CLECT_NK_receptors_like 164..286 CDD:153063 26/138 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.