DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment lectin-24Db and CLEC1B

DIOPT Version :9

Sequence 1:	NP_652641.1	Gene:	lectin-24Db / 53550	FlyBaseID:	FBgn0040102	Length:	359	Species:	Drosophila melanogaster
Sequence 2:	NP_001380271.1	Gene:	CLEC1B / 51266	HGNCID:	24356	Length:	229	Species:	Homo sapiens

Alignment Length:	103	Identity:	27/103 - (26%)
Similarity:	46/103 - (44%)	Gaps:	12/103 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   256 WQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYV----SVASGREVEFL 316
            |:.:..:|.||...:..|.::..::.|.|| .....|:|::..:|:..:.    ||.|....|||
Human   123 WEESKQYCTDMNATLLKIDNRNIVEYIKAR-THLIRWVGLSRQKSNEVWKWEDGSVISENMFEFL 186

  Fly   317 NWNAGEPNHGNEDENCVELIRSKMNDDPCHRKKHVICQ 354
                 |...||  .||......||:...|..|.:::|:
Human   187 -----EDGKGN--MNCAYFHNGKMHPTFCENKHYLMCE 217

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
lectin-24Db	NP_652641.1	ExsD	<44..>156	CDD:293411
		NAT_SF	<170..>229	CDD:302625
		CLECT	247..354	CDD:153057	26/101 (26%)
CLEC1B	NP_001380271.1	ITAM. /evidence=ECO:0000305\|PubMed:18215137	7..10
CLEC1B	NP_001380271.1	CLECT_NK_receptors_like	102..218	CDD:153063	27/103 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910