DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and REG3A

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_002571.1 Gene:REG3A / 5068 HGNCID:8601 Length:175 Species:Homo sapiens


Alignment Length:119 Identity:27/119 - (22%)
Similarity:51/119 - (42%) Gaps:22/119 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 WQSAVDFCRDM-GGYIAAIKDQEELDAISARL----DDKSY-WLGINDLQSSNTYVSVASGREVE 314
            |..|...|:.. .|.:.::....|...:|:.:    :..|| |:|::|    .|..:..:|...|
Human    61 WTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHD----PTQGTEPNGEGWE 121

  Fly   315 F-----LNWNAGE--PNHGNEDENCVELIRS----KMNDDPCHRKKHVICQ-TD 356
            :     :|:.|.|  |:..:...:|..|.||    :..|..|:.:...:|: ||
Human   122 WSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 24/114 (21%)
REG3ANP_002571.1 CLECT_REG-1_like 40..173 CDD:153064 25/115 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.