DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Ly49s5

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001012767.1 Gene:Ly49s5 / 503662 RGDID:1359728 Length:277 Species:Rattus norvegicus


Alignment Length:210 Identity:41/210 - (19%)
Similarity:85/210 - (40%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 QQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIPED----------FERKLQKLEQNQKDE 211
            ::.:|:..:|..|     ..:.:|:...|.:|||:.:..:          |.|     |||:..:
  Rat    71 EKHELQKTRNRHP-----NCSTMEKDINLKEETLRTMSVECTSSNALLDLFNR-----EQNRWYK 125

  Fly   212 LTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQ 276
            .||.......:.....|::    |  |.. |.:.:|. ..|...|......|::.......|.|:
  Rat   126 KTKTVLASPQHPARCVEMH----W--FCH-GIKCYYF-IMDIRTWHECKQTCQNYNLSFLKIDDK 182

  Fly   277 EELDAISARLDDKSYWLGI--NDLQSSNTYVSVASGREVEFLNWNAGEPNHGNEDENCVELIRSK 339
            :||..:...:...|||:|:  |:::...:::. :|....:.|   |.:|.  .:...|:....:.
  Rat   183 DELKFLQDHIIRDSYWVGLSYNNIKKEWSWID-SSPLNCDLL---ACKPL--QKTGYCIYFSMTG 241

  Fly   340 MNDDPCHRKKHVICQ 354
            ::.|.|.::...||:
  Rat   242 LHYDDCGKRHLCICE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 12/68 (18%)
CLECT 247..354 CDD:153057 21/108 (19%)
Ly49s5NP_001012767.1 Ly49 38..155 CDD:285577 19/100 (19%)
CLECT_NK_receptors_like 142..257 CDD:153063 26/129 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5382
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.