Sequence 1: | NP_652641.1 | Gene: | lectin-24Db / 53550 | FlyBaseID: | FBgn0040102 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102824.1 | Gene: | Clec9a / 502901 | RGDID: | 1562513 | Length: | 241 | Species: | Rattus norvegicus |
Alignment Length: | 195 | Identity: | 35/195 - (17%) |
---|---|---|---|
Similarity: | 74/195 - (37%) | Gaps: | 46/195 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 179 IEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKE-IYTKVFWPKFERIG 242
Fly 243 SRLFYINHKDAYD----WQSAVDFCRDMGGYIAAIKDQEELDAISARL----DDKSYWLGI-NDL 298
Fly 299 QSSNTYVSVASGREVEFLNWNAGE---------PNHGNEDENCVELIRSKMNDDPCHRKKHVICQ 354
Fly 355 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-24Db | NP_652641.1 | ExsD | <44..>156 | CDD:293411 | |
NAT_SF | <170..>229 | CDD:302625 | 9/50 (18%) | ||
CLECT | 247..354 | CDD:153057 | 23/124 (19%) | ||
Clec9a | NP_001102824.1 | ITAM-like | 5..10 | ||
CLECT_NK_receptors_like | 113..234 | CDD:153063 | 26/139 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 49 | 1.000 | Inparanoid score | I5382 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |