DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec12b

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001102823.1 Gene:Clec12b / 502900 RGDID:1560487 Length:275 Species:Rattus norvegicus


Alignment Length:313 Identity:58/313 - (18%)
Similarity:98/313 - (31%) Gaps:96/313 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QEQWNTSEALWLNETQGKLDRIQT---QLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESL 121
            :|:......||    :|....:.|   .|....::|.....:|..||....:::..||..:..  
  Rat    29 KEECPAQSPLW----RGAALSLMTLCLMLVTGLVTLATMFLQVSNDINSDSEKLSELQKIIHP-- 87

  Fly   122 KKMPAELDARLMKMENQQKTLGDQLEN-QINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKL 185
                            ||..|.:.|.| :..||:||.|.|:.||              :|.|.::
  Rat    88 ----------------QQDNLSESLNNSRKGLTEESLQSQISAL--------------LERQGQM 122

  Fly   186 LQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPK-FERIGSRLFYIN 249
            ..:..|                   |.....:....|..           || ::..|:..:|.:
  Rat   123 ATKLCK-------------------EFLIHASDHKCNPC-----------PKTWQWHGNSCYYFS 157

  Fly   250 HKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLD--DKSYWLGINDLQSSNTYVSVASGRE 312
            ..:...|:.:...|.|....:..|...||.|.:.::|.  ...:|||::...||..::       
  Rat   158 ANEEKSWRDSRKDCTDKNATLVKIDSIEERDLLQSQLSLTFSFFWLGLSWDSSSRNWL------- 215

  Fly   313 VEFLNWNAGE---PNHGNEDE--------NCVELIRSKMNDDPCHRKKHVICQ 354
                 |..|.   |...||.|        .|....|..:....|..:...||:
  Rat   216 -----WEDGSLPPPTLFNEKELASFNGSRECAYFERGNIYVSRCSAEISWICE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 19/99 (19%)
NAT_SF <170..>229 CDD:302625 5/58 (9%)
CLECT 247..354 CDD:153057 24/119 (20%)
Clec12bNP_001102823.1 CLECT_NK_receptors_like 142..264 CDD:153063 28/145 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5382
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.