DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Ly49i5

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001009501.1 Gene:Ly49i5 / 494211 RGDID:1359210 Length:277 Species:Rattus norvegicus


Alignment Length:243 Identity:47/243 - (19%)
Similarity:84/243 - (34%) Gaps:81/243 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIPED 196
            |.|..|:.... ..:||.|||.:|:       |:|.                     :::.||.:
  Rat    75 LQKTRNRHHNC-STMENDINLKEET-------LRNM---------------------SVQCIPSN 110

  Fly   197 FERKLQKLEQNQKDELTK---LGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQS 258
            ....|...|||:..:.||   ...|.:|..|       ::.|  |.. |.:.:|. ..|...|..
  Rat   111 TLLNLFNREQNRWYKKTKTVLASPQHTARCV-------EMHW--FCH-GIKCYYF-IMDIRTWHE 164

  Fly   259 AVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGI--NDLQSSNTYVSVASGREVEFLNWNAG 321
            ....|::.......|.|::||..:......:|||:|:  |:::...:::.               
  Rat   165 CKQTCQNYNLSFLKIDDKDELKFLQEHFIRESYWIGLSYNNIKKEWSWID--------------- 214

  Fly   322 EPNHGNEDENCVELIRSK---------------MNDDPCHRKKHVICQ 354
                 |...|| :|:..|               ::.|.|.::...||:
  Rat   215 -----NSPLNC-DLLACKPLQKTGYCIYFSMTGLHYDDCGKRHLCICE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 8/23 (35%)
NAT_SF <170..>229 CDD:302625 11/61 (18%)
CLECT 247..354 CDD:153057 21/123 (17%)
Ly49i5NP_001009501.1 Ly49 40..155 CDD:285577 25/118 (21%)
CLECT_NK_receptors_like 142..257 CDD:153063 25/140 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.