DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Ly49s4

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001009487.1 Gene:Ly49s4 / 494195 RGDID:1549723 Length:277 Species:Rattus norvegicus


Alignment Length:207 Identity:39/207 - (18%)
Similarity:78/207 - (37%) Gaps:45/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 NFEMRLAQ--------IEEQQKLLQETLKKIPED---FERKLQKL--EQNQ--KDELTKLGAQQS 220
            |.|::..|        :|:..||.:|.|:.:..:   :...|..:  |||:  |...|.|.:.|.
  Rat    72 NHELQKTQNRHHNCSTMEKDIKLKEEILRTMSAESVHYNALLDLINREQNRWYKKTKTVLASPQR 136

  Fly   221 ANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISAR 285
            ....      .::.|..:   |.:.:|.. .|...|:.....|::.......|..::||..:...
  Rat   137 TGGC------DEMHWFCY---GIKCYYFT-MDIRIWRECKQTCQNYSLSFLKIDVKDELKFLQDH 191

  Fly   286 LDDKSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEP--------NHGNEDENCVELIRSKMND 342
            :...:||:|           |..:.::.|: :|....|        |...:...|:....:.::|
  Rat   192 IIRDNYWIG-----------SSYNNKKKEW-SWIDNSPFNLDFVARNSLRKTGYCMYFSMAGLHD 244

  Fly   343 DPCHRKKHVICQ 354
            |.|.::...||:
  Rat   245 DDCGKRYLCICE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 16/72 (22%)
CLECT 247..354 CDD:153057 20/114 (18%)
Ly49s4NP_001009487.1 Ly49 38..155 CDD:285577 18/91 (20%)
CLECT_NK_receptors_like 142..257 CDD:153063 23/131 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.