Sequence 1: | NP_652641.1 | Gene: | lectin-24Db / 53550 | FlyBaseID: | FBgn0040102 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001009487.1 | Gene: | Ly49s4 / 494195 | RGDID: | 1549723 | Length: | 277 | Species: | Rattus norvegicus |
Alignment Length: | 207 | Identity: | 39/207 - (18%) |
---|---|---|---|
Similarity: | 78/207 - (37%) | Gaps: | 45/207 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 171 NFEMRLAQ--------IEEQQKLLQETLKKIPED---FERKLQKL--EQNQ--KDELTKLGAQQS 220
Fly 221 ANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISAR 285
Fly 286 LDDKSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEP--------NHGNEDENCVELIRSKMND 342
Fly 343 DPCHRKKHVICQ 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-24Db | NP_652641.1 | ExsD | <44..>156 | CDD:293411 | |
NAT_SF | <170..>229 | CDD:302625 | 16/72 (22%) | ||
CLECT | 247..354 | CDD:153057 | 20/114 (18%) | ||
Ly49s4 | NP_001009487.1 | Ly49 | 38..155 | CDD:285577 | 18/91 (20%) |
CLECT_NK_receptors_like | 142..257 | CDD:153063 | 23/131 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |