DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Klra1

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001009718.1 Gene:Klra1 / 494193 RGDID:1359586 Length:267 Species:Rattus norvegicus


Alignment Length:307 Identity:54/307 - (17%)
Similarity:100/307 - (32%) Gaps:101/307 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ETQGKLD----------------------RIQTQLAAQALSLEESAQKVPGDIKDRLDRMEH-LQ 114
            ||||.::                      .:...||..|||:.:.:|:            .| ||
  Rat    27 ETQGPIEAGHRKCSVLWQHIKIALGILCSHLLVTLAVLALSIIQYSQE------------NHDLQ 79

  Fly   115 TTLQ--ESLKKMPAELDARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLA 177
            .||:  .:...|.:.:|.:...|.|:            ::...|..:.|::||            
  Rat    80 KTLKHHHNCSTMQSIIDLKEEMMRNK------------SIECRSGSEYLDSLK------------ 120

  Fly   178 QIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIG 242
              .||::..::|             |...|..:.:.|               ..|:.|..:   |
  Rat   121 --REQERWYRKT-------------KTILNSTEHIGK---------------GVKIHWFCY---G 152

  Fly   243 SRLFY-INHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYVS 306
            .:.:| |..|.:  |......|::....:..|..:|||..:..|:...:||:|:........:..
  Rat   153 IKCYYFIMVKKS--WNGCQQTCQNSSLPLLKIDHEEELKFLQIRVISDNYWIGLKYHNEEKGWAW 215

  Fly   307 VASGREVEFLNWNAGEPNHGNEDENCVELIRSKMNDDPCHRKKHVIC 353
            ..:|.....|:    ......:|..||.|.:.::.:..|......||
  Rat   216 TDNGESKLVLS----RRKFNLKDGGCVFLSKRRLENTKCDNSYSCIC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 19/107 (18%)
NAT_SF <170..>229 CDD:302625 6/58 (10%)
CLECT 247..354 CDD:153057 22/108 (20%)
Klra1NP_001009718.1 Ly49 40..158 CDD:285577 28/186 (15%)
CLECT_NK_receptors_like 147..260 CDD:153063 24/121 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.