DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and colec11

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001007332.1 Gene:colec11 / 492459 ZFINID:ZDB-GENE-041114-11 Length:271 Species:Danio rerio


Alignment Length:137 Identity:41/137 - (29%)
Similarity:66/137 - (48%) Gaps:17/137 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDD-- 288
            :||..:||             |:..|:...::.|..||:..||::|..||.....||:..:.|  
Zfish   146 IKETDSKV-------------YLLVKEEKRYREAEVFCQGRGGHLAMPKDAAANRAIAGYVTDAG 197

  Fly   289 -KSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEPNHGNEDENCVELIRS-KMNDDPCHRKKHV 351
             ...::|||||:....:|.|.......|..|..||||:..:||:|||::.| :..|..|....:.
Zfish   198 LSRVYIGINDLEREGHFVYVERSPMTTFSRWREGEPNNAYDDEDCVEMVSSGEWIDVACQLTMYF 262

  Fly   352 ICQTDKE 358
            :|:.||:
Zfish   263 VCEFDKD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 34/110 (31%)
colec11NP_001007332.1 gly_rich_SclB <40..>110 CDD:468478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..112
CLECT_collectin_like 151..266 CDD:153061 37/127 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.