DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec4e

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001005897.2 Gene:Clec4e / 450223 RGDID:1359298 Length:215 Species:Rattus norvegicus


Alignment Length:127 Identity:32/127 - (25%)
Similarity:55/127 - (43%) Gaps:11/127 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 WPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAI-SARLDDKSYWLGINDL 298
            |..|:   |..::.: .....|.|:::.|.|||.::..|...||.:.: ..:...|.:::|:.|.
  Rat    85 WKHFQ---SSCYFFS-TTTLTWPSSLNNCSDMGAHLVVINTWEEQEFLFRTKPRKKEFYIGLTDQ 145

  Fly   299 QSSNTYVSVASGREVEFLN-WNAGEPNHGNEDENCVEL-----IRSKMNDDPCHRKKHVICQ 354
            .....:..|......|.|: |:|||||:....|:|..:     .|...||..|......||:
  Rat   146 VVEGQWRWVDDTPFTESLSFWDAGEPNNIVFVEDCATMRDSSNPRKNWNDVSCFFSMPWICE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 28/113 (25%)
Clec4eNP_001005897.2 CLECT_DC-SIGN_like 81..208 CDD:153060 32/127 (25%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000250|UniProtKB:Q9ULY5 170..172 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.