DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec4b2

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001005896.2 Gene:Clec4b2 / 450222 RGDID:1359354 Length:208 Species:Rattus norvegicus


Alignment Length:132 Identity:41/132 - (31%)
Similarity:59/132 - (44%) Gaps:18/132 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 WPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDK-SYWLGINDL 298
            |..|   ||..::.....| :|..:.:.|..||.::..|..|||.|.|:..||.: .|:.|::| 
  Rat    83 WKSF---GSHCYFTTDFVA-NWNESKEKCSHMGAHLLVIHSQEEQDFINGILDTRWGYFTGLSD- 142

  Fly   299 QSSNTYVSVAS---GREVEFLNWNAGEPNHGNEDENCVELIRSK-----MNDDPCHRKKHVICQT 355
            |..|.:..:..   ...|.|  |:..|||  |:.|.|||:...|     .||..|..:...|||.
  Rat   143 QGQNQWQWIDQTPYNESVTF--WHEDEPN--NDYEKCVEINHHKDIGWGWNDIVCSSEHKSICQV 203

  Fly   356 DK 357
            .|
  Rat   204 KK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 34/115 (30%)
Clec4b2NP_001005896.2 CLECT_DC-SIGN_like 79..202 CDD:153060 38/127 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.