DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and clec-224

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001041207.2 Gene:clec-224 / 4363112 WormBaseID:WBGene00044790 Length:195 Species:Caenorhabditis elegans


Alignment Length:99 Identity:19/99 - (19%)
Similarity:41/99 - (41%) Gaps:20/99 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 DAYDWQSAVDFCRDMGGYIAAIKDQEEL---------------DAISARLDDKSYWLGINDLQSS 301
            |....:||...|.::|.::|:.:..:|.               |.:|.....:..|:|::  :::
 Worm    74 DVLTQESAEQECVELGAHLASFETTDEATSVKNLVLSSPLFSDDLLSFTSSSQETWIGLS--KTN 136

  Fly   302 NTYVSVASGREVEFLNWNAGEPNHGNEDENCVEL 335
            |......:..:|:|.|...|...:|   .:||.:
 Worm   137 NGAWKWVNSSDVDFTNLPDGTTVNG---ASCVSM 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 19/99 (19%)
clec-224NP_001041207.2 CLECT 57..188 CDD:214480 19/99 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.