DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and ASGR2

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_011522164.2 Gene:ASGR2 / 433 HGNCID:743 Length:410 Species:Homo sapiens


Alignment Length:341 Identity:69/341 - (20%)
Similarity:117/341 - (34%) Gaps:92/341 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LKDPP-------NQCGEFCLS-------VLQPLLDHIVKHQEQWNTSEALWLNETQGKLDRIQTQ 84
            ||.||       ..|...|.|       :|..::..:...|.:.:..:..|   .:|      .|
Human   132 LKGPPPAQPLAQRLCSMVCFSLLALSFNILLLVVICVTGSQSEGHGGQQGW---ARG------AQ 187

  Fly    85 LAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESLKKMPAELDARLMKMENQQKTLGDQLENQ 149
            |.|:..||:|:.....             .:||.|            :..:.....::||:: ..
Human   188 LQAELRSLKEAFSNFS-------------SSTLTE------------VQAISTHGGSVGDKI-TS 226

  Fly   150 INLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTK 214
            :....|.||..|:|..:|:..:                  ||..|.|.     :....|.:.|..
Human   227 LGAKLEKQQQDLKADHDALLFH------------------LKHFPVDL-----RFVACQMELLHS 268

  Fly   215 LGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEEL 279
            .|:|::...|...|.....:|  |...|..           |..|..:|:....::..|...||.
Human   269 NGSQRTCCPVNWVEHQGSCYW--FSHSGKA-----------WAEAEKYCQLENAHLVVINSWEEQ 320

  Fly   280 DAISARLDDKSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEPN--HGNE---DENCVEL-IRS 338
            ..|....:..:.|:|:.|...|..:|.....|. .:.||...:|:  ||:|   .|:|||: ...
Human   321 KFIVQHTNPFNTWIGLTDSDGSWKWVDGTDYRH-NYKNWAVTQPDNWHGHELGGSEDCVEVQPDG 384

  Fly   339 KMNDDPCHRKKHVICQ 354
            :.|||.|.:....:|:
Human   385 RWNDDFCLQVYRWVCE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 17/118 (14%)
NAT_SF <170..>229 CDD:302625 9/58 (16%)
CLECT 247..354 CDD:153057 27/112 (24%)
ASGR2XP_011522164.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5380
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.