DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CG34033

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001033937.1 Gene:CG34033 / 3885602 FlyBaseID:FBgn0054033 Length:168 Species:Drosophila melanogaster


Alignment Length:118 Identity:30/118 - (25%)
Similarity:54/118 - (45%) Gaps:13/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 YINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARL--DDKSYWLGINDLQSSNTYVSVAS 309
            |.:.|.| .|.||:..|:.:...:|.:..:..|..:.:::  ||..||.|:| .....||..|::
  Fly    32 YFSEKTA-SWFSALTICKSLHMCLADLNTEVTLFQMKSKINQDDHEYWFGLN-AHDKPTYRYVSN 94

  Fly   310 GREVEFLNWNAGEPNHGNEDENCVELIRS----KMNDDPCHRKKHVIC-QTDK 357
            .:.:|:...|:...|    :|.||.:.:.    |.....|...:..|| :||:
  Fly    95 NKSIEYSPHNSKLVN----NEGCVYVKQQNDFFKFESAKCREHRRFICTKTDE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 28/113 (25%)
CG34033NP_001033937.1 CLECT 30..140 CDD:153057 28/113 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.