DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and KLRC2

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_002251.2 Gene:KLRC2 / 3822 HGNCID:6375 Length:231 Species:Homo sapiens


Alignment Length:243 Identity:43/243 - (17%)
Similarity:90/243 - (37%) Gaps:56/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 MENQQKTLGDQLENQINLTKESQQDQLEALKNAMPIN-FEMRLAQIE---EQQKLLQETLKKI-- 193
            |..|:.|.     ::::|.::.::.|.:...|...|: .|..:.|:|   :...|..:.:.||  
Human     1 MNKQRGTF-----SEVSLAQDPKRQQRKPKGNKSSISGTEQEIFQVELNLQNPSLNHQGIDKIYD 60

  Fly   194 -------PEDFERK-------------------LQKLEQNQKDELTKLGAQQSANQVTLKEIYTK 232
                   ||....:                   :..||||          ..|.|..|.|..:..
Human    61 CQGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPFLEQN----------NFSPNTRTQKARHCG 115

  Fly   233 VFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGIND 297
            ....::....:..:||. |:...|:.::..|......:.:|.::||:..:::.|  .|.|:|:..
Human   116 HCPEEWITYSNSCYYIG-KERRTWEESLLACTSKNSSLLSIDNEEEMKFLASIL--PSSWIGVFR 177

  Fly   298 LQSSNTYVSVASGREVEFLNWNAGEPNHGNEDENCVELIRSKMNDDPC 345
            ..|.:.:|::..      |.:.....:..|.:.||..|..:::....|
Human   178 NSSHHPWVTING------LAFKHKIKDSDNAELNCAVLQVNRLKSAQC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 4/20 (20%)
NAT_SF <170..>229 CDD:302625 17/90 (19%)
CLECT 247..354 CDD:153057 20/99 (20%)
KLRC2NP_002251.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 6/35 (17%)
CLECT_NK_receptors_like 117..229 CDD:153063 20/112 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.