DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and nw

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster


Alignment Length:157 Identity:39/157 - (24%)
Similarity:65/157 - (41%) Gaps:50/157 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SLEESAQKV----PGDIKD------------RLDRMEHLQTTLQE-----------------SLK 122
            :.||.|:::    .||||:            .:..:|.:|..||:                 ...
  Fly   307 NFEEHARELSNDNDGDIKEHVFPLSDNELHPEVHSIEEVQQQLQQEDADADSAPAPAAAEDNESS 371

  Fly   123 KMPAELDARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKN-AMPINFEMRLAQIEEQQKLL 186
            :..||.|.     |::|    |..|.:.:|..|:..|.::|.:. |||.:.|...|.|||:    
  Fly   372 QHDAEADG-----EHEQ----DGAEGETDLENETPVDLIKANEPLAMPSSTESPAAAIEER---- 423

  Fly   187 QETLKKIPEDFERKLQKLEQNQKDELT 213
               :|:|.:||::.....|...|:|||
  Fly   424 ---IKQIAQDFQKMASSQELQPKEELT 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118 39/157 (25%)
CLECT 247..354 CDD:153057
nwNP_001027435.2 CLECT 31..176 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.