DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CG14499

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001261072.3 Gene:CG14499 / 37086 FlyBaseID:FBgn0034317 Length:188 Species:Drosophila melanogaster


Alignment Length:137 Identity:27/137 - (19%)
Similarity:54/137 - (39%) Gaps:26/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 GSRLFYINHKDAYDWQSAVD-FCRDMGGYIAAIKDQEELDAISARL-----DDKSYWLGINDLQS 300
            |..|.:.|     .|::.:| .|:.:...:.:..::.|..||:..|     .....|...|.|..
  Fly    40 GKCLLFDN-----SWKNFLDRHCQSLNAGLLSFSNKMEFTAINEWLTTVVPQSPELWTSGNKLGG 99

  Fly   301 SNTYVSVASGREVEFLNWNAGEPNHGNEDENCVELIRS-------------KMNDDPCHRKKHVI 352
            |..|...::|::..:|.|.||:|.....|  |:.|:.:             :::...|.:....:
  Fly   100 SEDYYWQSTGKKAFYLPWQAGQPTPITGD--CLTLLANVTMTAEGTTMSEHRLSVRGCTKWAPHV 162

  Fly   353 CQTDKEV 359
            ||...::
  Fly   163 CQAPLQI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 23/125 (18%)
CG14499NP_001261072.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.