DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Cd209

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001102319.1 Gene:Cd209 / 363856 RGDID:1561104 Length:237 Species:Rattus norvegicus


Alignment Length:230 Identity:47/230 - (20%)
Similarity:79/230 - (34%) Gaps:75/230 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 EDFERKLQKLEQNQKDEL---------------TKLG-------AQQSANQVTL----------- 226
            |..|...|:|:..:.:|.               ||.|       .:||.|.:.|           
  Rat     3 ESMESNTQQLDNPEDEEYLMSGSRYSIISSRLRTKFGIKSLAEYTKQSHNPLVLPLLSFLFLAGL 67

  Fly   227 -------------KEIYTKVF---------------------WPKFERIGSRLFYINHKDAYDWQ 257
                         .|:..|::                     |..|.  ||..|:  .|...:|.
  Rat    68 LLIILVLVSKVPSSEVQDKIYQELMQLKTEVHDGLCQPCPRDWTFFN--GSCYFF--SKSQRNWH 128

  Fly   258 SAVDFCRDMGGYIAAIKDQEELDAISARLDDKS-YWLGINDLQSSNTYVSV-ASGREVEFLN-WN 319
            :::..|:::|..:..::..||...:......:. .|:|::|:.:..|:..| .|.....|.. ||
  Rat   129 NSITACKELGAQLVIVETDEEQTFLQQTSKTRGPTWMGLSDMHNEATWHWVDGSPLSPSFAQYWN 193

  Fly   320 AGEPNHGNEDENCVELIRSKMNDDPCHRKKHVICQ 354
            .||||:.. ||:|.|......||..|..:...||:
  Rat   194 RGEPNNVG-DEDCAEFSGDGWNDLRCDTRIFWICK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 12/79 (15%)
CLECT 247..354 CDD:153057 27/109 (25%)
Cd209NP_001102319.1 CLECT_DC-SIGN_like 106..228 CDD:153060 33/127 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.