Sequence 1: | NP_652641.1 | Gene: | lectin-24Db / 53550 | FlyBaseID: | FBgn0040102 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102319.1 | Gene: | Cd209 / 363856 | RGDID: | 1561104 | Length: | 237 | Species: | Rattus norvegicus |
Alignment Length: | 230 | Identity: | 47/230 - (20%) |
---|---|---|---|
Similarity: | 79/230 - (34%) | Gaps: | 75/230 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 195 EDFERKLQKLEQNQKDEL---------------TKLG-------AQQSANQVTL----------- 226
Fly 227 -------------KEIYTKVF---------------------WPKFERIGSRLFYINHKDAYDWQ 257
Fly 258 SAVDFCRDMGGYIAAIKDQEELDAISARLDDKS-YWLGINDLQSSNTYVSV-ASGREVEFLN-WN 319
Fly 320 AGEPNHGNEDENCVELIRSKMNDDPCHRKKHVICQ 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-24Db | NP_652641.1 | ExsD | <44..>156 | CDD:293411 | |
NAT_SF | <170..>229 | CDD:302625 | 12/79 (15%) | ||
CLECT | 247..354 | CDD:153057 | 27/109 (25%) | ||
Cd209 | NP_001102319.1 | CLECT_DC-SIGN_like | 106..228 | CDD:153060 | 33/127 (26%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |