DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec4d

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001003707.2 Gene:Clec4d / 362432 RGDID:1303339 Length:218 Species:Rattus norvegicus


Alignment Length:137 Identity:38/137 - (27%)
Similarity:57/137 - (41%) Gaps:29/137 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 VFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDK-SYWLGIN 296
            |.|..|:  .:..|.:|  |...|..:...|..|..::..|..:.|.|.::..||:: ||:||: 
  Rat    84 VSWRAFQ--SNCYFPLN--DNQTWHESERNCSGMSSHLVTINTEAEQDFVTQLLDEQFSYFLGL- 143

  Fly   297 DLQSSNTYVSVAS----------GREVEFLNWNAGEPNHGNEDENCVELIRSK----MNDDPCHR 347
                  :|..|..          ...|.|  |..|||....| |:||.|:..:    .||.|||.
  Rat   144 ------SYEKVEGQWQWVDKTPFNPNVVF--WKVGEPKDYME-EDCVVLVYDQDKWVWNDFPCHF 199

  Fly   348 KKHVICQ 354
            :...||:
  Rat   200 EMGRICK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 33/121 (27%)
Clec4dNP_001003707.2 CLECT_DC-SIGN_like 82..206 CDD:153060 37/135 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.