DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Acp29AB

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster


Alignment Length:233 Identity:66/233 - (28%)
Similarity:113/233 - (48%) Gaps:35/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 ARLMKMENQQKTLGDQL---ENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLK 191
            |.|...:..|.|: ||:   :|........:|::..|:.:.|    |||:|          .:|.
  Fly    30 ATLPSPQTPQNTI-DQIGINQNYWFTYNALKQNETLAIIDTM----EMRIA----------SSLL 79

  Fly   192 KIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDW 256
            :.....|.:||.|:...:...:.:   :::|.:.::         :||::|||.|:|.......|
  Fly    80 EFKAQMEIQLQPLKIIMRHHASNI---KASNNIKMR---------RFEKVGSRHFHIEKNLMQTW 132

  Fly   257 QSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDL-QSSNTYVSVASGREVEFLNWNA 320
            ..|...||.|.|::|.|:|:.|||.|.|...:.|||:.|:.| ::..|:||..:|||..|:.|.:
  Fly   133 FEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKS 197

  Fly   321 GEPNHGNEDEN-CVELIRSKMNDDPCHRKKHVICQTDK 357
               |...:.:| ||.:...:|:.|.|..||..:||.|:
  Fly   198 ---NQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQADQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 7/28 (25%)
NAT_SF <170..>229 CDD:302625 10/58 (17%)
CLECT 247..354 CDD:153057 37/108 (34%)
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 38/110 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4072
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112956at50557
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.