DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CG15818

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster


Alignment Length:376 Identity:107/376 - (28%)
Similarity:160/376 - (42%) Gaps:110/376 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRLEKCIVYLLVACNLVESRAESTENSRSVCLLKDPPNQCGEFCLSVLQPLLDHIVKHQEQWNT 65
            ||...:.|:...:......|..|:.|..|.||||.||||||.|:|:|.|||::||:.|.|:.|..
  Fly     1 MFSSTRIILCAFLLLYPYGSLIEAQEGRRYVCLLSDPPNQCSEYCVSALQPVIDHLSKEQQDWGA 65

  Fly    66 SEALWLNETQGKLDRIQTQLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESLKKMPAELDA 130
            .| :.||.:..|||:|:.||.|..:                                        
  Fly    66 CE-VKLNGSVAKLDKIEDQLTATQI---------------------------------------- 89

  Fly   131 RLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKI-- 193
                                                           |||.||..|...:.|.  
  Fly    90 -----------------------------------------------QIEAQQAFLVNNISKAIK 107

  Fly   194 PEDFERKLQKLEQNQ-------KDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHK 251
            .||.|:||:.:|.||       ||...:...|.:|.|.||.:|..|:...::::||||.|||.|.
  Fly   108 TEDLEQKLKDIEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEHN 172

  Fly   252 DAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYVSVASGREVEFL 316
            ...:|::|...|.:|||::||.::.||.:||..:|:..:||||:|||.....::|:|||:...:.
  Fly   173 LQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLAKQGEFISLASGKRATYF 237

  Fly   317 NWNAGEPNHGNEDENC--------VELIRSKMNDDPCHRKKHVICQTDKEV 359
            .|...||.:.|..::|        :.::.|...|     ..|.|||:|.:|
  Fly   238 KWRKNEPKYNNPTQHCAYVFGHENIMIVLSCTTD-----VMHFICQSDSDV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 20/111 (18%)
NAT_SF <170..>229 CDD:302625 22/67 (33%)
CLECT 247..354 CDD:153057 36/114 (32%)
CG15818NP_609116.1 CLECT 164..278 CDD:153057 39/118 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.