DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CLEC4D

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_525126.2 Gene:CLEC4D / 338339 HGNCID:14554 Length:215 Species:Homo sapiens


Alignment Length:117 Identity:32/117 - (27%)
Similarity:55/117 - (47%) Gaps:13/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 YINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDK-SYWLGINDLQSSNTYVSVASG 310
            |....|...|..:...|..||.::..|..:.|.:.|...||.: ||:||:.|..:...:..|   
Human    96 YFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWV--- 157

  Fly   311 REVEF----LNWNAGEPNHGNEDENCVELIRSK----MNDDPCHRKKHVICQ 354
            .:..|    :.|:..||:: ::.||||.|:.::    .||.||:.:...||:
Human   158 DQTPFNPRRVFWHKNEPDN-SQGENCVVLVYNQDKWAWNDVPCNFEASRICK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 31/115 (27%)
CLEC4DNP_525126.2 CLECT_DC-SIGN_like 84..208 CDD:153060 31/115 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.