DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and lectin-37Db

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster


Alignment Length:119 Identity:50/119 - (42%)
Similarity:70/119 - (58%) Gaps:6/119 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 IGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDK-SYWLGINDLQSSNTY 304
            ||.:.:||:.... :|..|.:.||..||::..::.:|||:.:|..|... ||||.||||.....|
  Fly    31 IGEKQYYISLAKT-NWFEASNHCRQNGGFLLNLESREELELLSPHLHPAYSYWLSINDLGERGVY 94

  Fly   305 VSVASGREVEFLNWNAGEPNHGNEDENCVELIRS----KMNDDPCHRKKHVICQ 354
            ||.|:|.|..||||:||||::.:..:.||||..|    :|||.||:.....|||
  Fly    95 VSEATGLEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYSSVAFICQ 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 46/111 (41%)
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 46/114 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438683
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.