DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CG2839

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster


Alignment Length:366 Identity:98/366 - (26%)
Similarity:150/366 - (40%) Gaps:116/366 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KCIVYLLV------ACNLVESRAESTENSRSVCLLKDP-------PNQCGEFCLSVLQPLLDHIV 57
            :|..|.|.      :||:.      .||.    :|:||       ..:.||.||..:.|:|::|.
  Fly     3 ECATYFLFVFFSYGSCNVF------AEND----ILQDPLISSYDRLKKLGEMCLIDILPILENIS 57

  Fly    58 KHQEQWNTSEALWLNETQGKLDRIQTQLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESLK 122
            :.|::..|:.....|||||.||||:                                        
  Fly    58 EQQKEGYTANFRIFNETQGILDRIE---------------------------------------- 82

  Fly   123 KMPAELDARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQ 187
                                |.|         |....||:|||..|..:|....|::|.:.|.| 
  Fly    83 --------------------GHQ---------EVNDKQLKALKVKMEGHFMDLHAKMEIKVKKL- 117

  Fly   188 ETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKV-FWPKFERIGSRLFYINHK 251
                    ..|:.|:|          .|.|.|.:  :..:.:.:|| ..|:||::|||.|||...
  Fly   118 --------SLEKSLRK----------ALNALQCS--LDTRNVSSKVSLHPEFEKVGSRFFYIERH 162

  Fly   252 DAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYVSVASGREVEFL 316
            ...:|..|:..||:|||::|:.:::|||..||.:||.:||||.::||.....|:|:.||.:..||
  Fly   163 VKQNWFDAMTKCREMGGHLASPQNEEELHLISQKLDTESYWLDLSDLTDHGQYISLVSGSKAPFL 227

  Fly   317 NWNAGEPNHGNEDENCVELIRSKMNDDPCHRKKHVICQTDK 357
            .||.|:||  .|:..||.:.........|..:...|||.::
  Fly   228 KWNKGQPN--RENAQCVRVKGGLYQTFQCDHRVLFICQANQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 18/111 (16%)
NAT_SF <170..>229 CDD:302625 11/58 (19%)
CLECT 247..354 CDD:153057 39/106 (37%)
CG2839NP_608540.1 CLECT 147..263 CDD:214480 46/117 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.