DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Cd72

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001015016.1 Gene:Cd72 / 313498 RGDID:1309757 Length:364 Species:Rattus norvegicus


Alignment Length:310 Identity:65/310 - (20%)
Similarity:115/310 - (37%) Gaps:110/310 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CIVY----LLVACNLVESRAESTENSRSVCLLKDPPNQCGEFCLSVLQPLLDHIVKHQEQWNTSE 67
            |:.|    ||:||.::           .|.::          ||.|      ..::..:|:....
  Rat    90 CLQYSLLGLLLACLML-----------GVAII----------CLGV------RYLQVSQQFEQVS 127

  Fly    68 ALWLNETQGKLDRIQTQLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESLKKMPAELDARL 132
            .:|    :.....:|.||..:...|::..:    |:::....:...|.|.||..|         :
  Rat   128 RIW----EATNSSLQQQLREEKRQLKQKVE----DLRESRRELNSTQDTFQEKQK---------M 175

  Fly   133 MKMENQQKTLGD-QLENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIPED 196
            .::..||  |.| |.|:|  .||||       ||.             |||::          :|
  Rat   176 YEVTKQQ--LQDCQAESQ--RTKES-------LKT-------------EEQRR----------QD 206

  Fly   197 FERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVD 261
            .::.|    :|.:|.|.:|.:..|       :......|.:.|:   |.|||::... ..:.:..
  Rat   207 LDQSL----RNTRDTLRRLSSCSS-------DTCCPSGWVQHEK---RCFYISNTPR-SLEESRK 256

  Fly   262 FCRDMGGYIAAIKD------QEEL-DAISARLD-DKSYWLGINDLQSSNT 303
            :|..:...:|.:.:      |:.| |.:...|| .||||:.    |.|:|
  Rat   257 YCTSLSSKLAVLNEPPRYSLQDSLPDGLKKLLDRSKSYWIE----QMSHT 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 24/112 (21%)
NAT_SF <170..>229 CDD:302625 10/58 (17%)
CLECT 247..354 CDD:153057 16/65 (25%)
Cd72NP_001015016.1 DegS 124..>220 CDD:283127 32/150 (21%)
CLECT 230..>296 CDD:295302 16/69 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.