DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CD209

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_066978.1 Gene:CD209 / 30835 HGNCID:1641 Length:404 Species:Homo sapiens


Alignment Length:367 Identity:92/367 - (25%)
Similarity:156/367 - (42%) Gaps:98/367 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SVLQPLLDHIVK-----HQEQWNTSEALWLNETQ-----------GKLDRIQ---TQLAAQALSL 92
            ::|..||..:.|     .||| :..:|::.|.||           .||..|.   |||.|....|
Human    51 TLLAGLLVQVSKVPSSISQEQ-SRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGEL 114

  Fly    93 EESAQKVPGDIKDRLDRMEHLQTTLQESLKKMPAELDARLMKMENQ----QKTLGDQLENQINLT 153
            .|         |.:|..:....|.|:.::.::|.:  ::|.::..:    :..:|:..|      
Human   115 PE---------KSKLQEIYQELTRLKAAVGELPEK--SKLQEIYQELTWLKAAVGELPE------ 162

  Fly   154 KESQQD---QLEALKNAMPINFEMRLAQIEEQQKLLQETLK------KIPEDFERKLQKLEQNQK 209
            |...|:   :|..||.|:.     .|.:..:||::.||..:      ::||  :.|.|::.|   
Human   163 KSKMQEIYQELTRLKAAVG-----ELPEKSKQQEIYQELTRLKAAVGELPE--KSKQQEIYQ--- 217

  Fly   210 DELTKLGA------QQSANQVTLKEIYTKVF----------------WPKFERIGSRLFYINHKD 252
             |||:|.|      ::|..|    |||.::.                |..|:  |:..|..|.: 
Human   218 -ELTRLKAAVGELPEKSKQQ----EIYQELTQLKAAV
ERLCHPCPWEWTFFQ--GNCYFMSNSQ- 274

  Fly   253 AYDWQSAVDFCRDMGGYIAAIKDQEE---LDAISARLDDKSYWLGINDLQSSNTYVSVASGREVE 314
             .:|..::..|:::|..:..||..||   |...|:| .::..|:|::||....|:..|.....:.
Human   275 -RNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSR-SNRFTWMGLSDLNQEGTWQWVDGSPLLP 337

  Fly   315 FLN--WNAGEPNHGNEDENCVELIRSKMNDDPCHRKKHVICQ 354
            ...  ||.||||:..| |:|.|...:..|||.|:..|..||:
Human   338 SFKQYWNRGEPNNVGE-EDCAEFSGNGWNDDKCNLAKFWICK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 29/131 (22%)
NAT_SF <170..>229 CDD:302625 17/70 (24%)
CLECT 247..354 CDD:153057 33/111 (30%)
CD209NP_066978.1 Endocytosis signal 14..15
Endocytosis signal. /evidence=ECO:0000255 16..18
Endocytosis signal. /evidence=ECO:0000255 31..34
transmembrane domain 36..59 3/7 (43%)
PilO 38..>184 CDD:294757 34/155 (22%)
neck domain 60..249 51/221 (23%)
CLECT_DC-SIGN_like 256..379 CDD:153060 38/129 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.