DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and RGD1564571

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_221808.5 Gene:RGD1564571 / 304197 RGDID:1564571 Length:207 Species:Rattus norvegicus


Alignment Length:186 Identity:53/186 - (28%)
Similarity:82/186 - (44%) Gaps:18/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 MRLAQIEEQQKLLQETLKK---IPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFW 235
            ::|..|.....||...|.|   :|...|...||...:||.:..|.|...........       |
  Rat    27 LQLISIVLLAALLTAILVKGSEVPSSQEHDQQKQRMHQKLDQLKTGLDHLCRPCPWD-------W 84

  Fly   236 PKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDK-SYWLGINDLQ 299
            ..|:  |:..|:...:.  .|:.:|..|:|||..:..||..||...:......| :.|:|::|.|
  Rat    85 TFFQ--GNCYFFSTFQK--KWKESVIACKDMGAQLVVIKSYEEQSFLQRTSKMKGNTWIGLSDSQ 145

  Fly   300 SSNTYVSVASGREVEFLN-WNAGEPNHGNEDENCVELIRSKMNDDPCHRKKHVICQ 354
            ..:.::.| .|..:::.| |:|||||: ..||:|||......||..|..:|..||:
  Rat   146 EEDQWLWV-DGSPLQWRNYWSAGEPNN-LYDEDCVEFSSYGWNDISCSFEKFWICK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 14/57 (25%)
CLECT 247..354 CDD:153057 34/108 (31%)
RGD1564571XP_221808.5 CLECT_DC-SIGN_like 80..200 CDD:153060 39/133 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.