DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Colec10

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:120 Identity:37/120 - (30%)
Similarity:64/120 - (53%) Gaps:10/120 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 FYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKS----YWLGINDLQSSNTYVS 306
            ||...::..:::.::..||..||.:|..|| |.::.:.|....||    .::|:|||:....||.
  Rat   159 FYYIVQEEKNYRESLTHCRIRGGMLAMPKD-EVVNTLIADYVAKSGFFRVFIGVNDLEKEGQYVF 222

  Fly   307 VASGREVEFLNWNAGEPN--HGNEDENCVELIRS-KMNDDPCHRKKHVICQTDKE 358
            ..:.....:.||..|||:  :|:||  |||::.| :.||..||...:.:|:..|:
  Rat   223 TDNTPLQNYSNWKEGEPSDPYGHED--CVEMLSSGRWNDTECHLTMYFVCEFVKK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 34/113 (30%)
Colec10NP_001124013.1 Collagen 45..94 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 36/115 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.