DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec4m

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_038945074.1 Gene:Clec4m / 288378 RGDID:1561466 Length:336 Species:Rattus norvegicus


Alignment Length:246 Identity:60/246 - (24%)
Similarity:110/246 - (44%) Gaps:25/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 EHLQTTLQESLKKMPAELDARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMR 175
            |..|..:.|.|.::..||.:|:...:.|.:::.:::..|:...|..       |.:.:|: |:: 
  Rat    95 EPKQEKILEELNQLTDELMSRIPISQGQNESMQEKISEQLTQLKVE-------LLSRIPV-FQV- 150

  Fly   176 LAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFER 240
              |.|..|:.:.|.|.::..:...|:..|:...:.:..|:..|....:..|..:.....|.....
  Rat   151 --QNESMQEKISEQLTQLKAELLSKIPSLQVQDESKQEKIYQQLVQMKTELLRLCRLCPWDWTFL 213

  Fly   241 IGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKS---YWLGINDLQSSN 302
            :|:  .|...|...:|..||..|::....:..|...||...:  :|..|:   .|:|::||::..
  Rat   214 LGN--CYFLSKSQRNWNDAVRACKEEKAQLVIINSDEEQTFL--QLTSKAKGPTWMGLSDLKNEA 274

  Fly   303 TYV----SVASGREVEFLNWNAGEPNHGNEDENCVELIRSKMNDDPCHRKK 349
            |::    |..|.|..::  ||.||||:..| |:|||......||..|..||
  Rat   275 TWLWVDGSTLSSRFQKY--WNRGEPNNIGE-EDCVEFAGDGWNDSKCELKK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 10/44 (23%)
NAT_SF <170..>229 CDD:302625 11/58 (19%)
CLECT 247..354 CDD:153057 35/110 (32%)
Clec4mXP_038945074.1 CLECT_DC-SIGN_like 206..328 CDD:153060 37/124 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.