DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec4a1

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_955015.1 Gene:Clec4a1 / 269799 MGIID:3036291 Length:245 Species:Mus musculus


Alignment Length:116 Identity:29/116 - (25%)
Similarity:54/116 - (46%) Gaps:10/116 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 YINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDK-SYWLGINDLQSSNTYVSV-AS 309
            |...:|...|..:.:.|...|.::..|:.|||.|.|:..|:.: :|::|::|.:....:..| .:
Mouse   126 YFTSRDTASWSKSEEKCSLRGAHLLVIQSQEEQDFITNTLNPRAAYYVGLSDPKGHGQWQWVDQT 190

  Fly   310 GREVEFLNWNAGEPNHGNEDENCVELIRSK------MNDDPCHRKKHVICQ 354
            ..:....:|::.||: || .|.||.|....      .:..||.....:||:
Mouse   191 PYDQNATSWHSDEPS-GN-TEFCVVLSYHPNVKGWGWSVAPCDGDHRLICE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 28/114 (25%)
Clec4a1NP_955015.1 CLECT_DC-SIGN_like 114..240 CDD:153060 29/116 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.