DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec4a2

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001163804.1 Gene:Clec4a2 / 26888 MGIID:1349412 Length:262 Species:Mus musculus


Alignment Length:231 Identity:57/231 - (24%)
Similarity:87/231 - (37%) Gaps:60/231 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIPEDFERKLQ 202
            ::|...:.:.|::|.||....      ..|.||.           |:.|  ||:.|..|      
Mouse    78 EKKAAKNIMHNELNCTKSVSP------MEAPPIG-----------QRAL--TLESIEID------ 117

  Fly   203 KLEQNQKDELTKLGAQQSANQVTLKEIYTKVFW---PKFERI-GSRLFYI-NHKDAYDWQSAVDF 262
                        ||.....::|          |   ||..|: ||..:.: ....:..|..:.:.
Mouse   118 ------------LGILAPEDKV----------WSCCPKDWRLFGSHCYLVPTVSSSASWNKSEEN 160

  Fly   263 CRDMGGYIAAIKDQEELDAISARLD-DKSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEPNHG 326
            |..||.::..|:.|||.|.|:..|| ..:|::|:.|...........:..|.....|:.|||:.|
Mouse   161 CSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSG 225

  Fly   327 NEDENCVELI-RSK----MNDDPCHRKKHVICQTDK 357
            |  |.|..:| |.|    .||..|..|:..:||..|
Mouse   226 N--EKCATIIYRWKTGWGWNDISCSLKQKSVCQMKK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 5/17 (29%)
NAT_SF <170..>229 CDD:302625 10/58 (17%)
CLECT 247..354 CDD:153057 31/113 (27%)
Clec4a2NP_001163804.1 CLECT_DC-SIGN_like 131..257 CDD:153060 37/127 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.