Sequence 1: | NP_652641.1 | Gene: | lectin-24Db / 53550 | FlyBaseID: | FBgn0040102 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055173.1 | Gene: | CLEC4E / 26253 | HGNCID: | 14555 | Length: | 219 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 42/199 - (21%) |
---|---|---|---|
Similarity: | 75/199 - (37%) | Gaps: | 58/199 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 175 RLAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELT--KLGAQQSANQVTLKEIYTKVFWPK 237
Fly 238 FERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDD-KSYWLGINDLQSS 301
Fly 302 NTYVSVASG-----------REVEFLNWNAGEPNHGNEDENCVEL-----IRSKMNDDPCHRKKH 350
Fly 351 VICQ 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-24Db | NP_652641.1 | ExsD | <44..>156 | CDD:293411 | |
NAT_SF | <170..>229 | CDD:302625 | 11/55 (20%) | ||
CLECT | 247..354 | CDD:153057 | 27/123 (22%) | ||
CLEC4E | NP_055173.1 | CLECT_DC-SIGN_like | 80..207 | CDD:153060 | 32/148 (22%) |
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000303|PubMed:24101491 | 169..171 | 1/1 (100%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |