DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CLEC4E

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_055173.1 Gene:CLEC4E / 26253 HGNCID:14555 Length:219 Species:Homo sapiens


Alignment Length:199 Identity:42/199 - (21%)
Similarity:75/199 - (37%) Gaps:58/199 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 RLAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELT--KLGAQQSANQVTLKEIYTKVFWPK 237
            |:.|..:::|.      ::||:|            .||:  ..|:....|...|.       |..
Human    47 RIFQTCDEKKF------QLPENF------------TELSCYNYGSGSVKNCCPLN-------WEY 86

  Fly   238 FERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDD-KSYWLGINDLQSS 301
            |:   |..::.: .|...|..::..|..||.::..|..|||.:.:|.:... :.:::|::|    
Human    87 FQ---SSCYFFS-TDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSD---- 143

  Fly   302 NTYVSVASG-----------REVEFLNWNAGEPNHGNEDENCVEL-----IRSKMNDDPCHRKKH 350
                .|..|           :.:.|  |:.||||:....|:|..:     .|...||..|.....
Human   144 ----QVVEGQWQWVDGTPLTKSLSF--WDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYF 202

  Fly   351 VICQ 354
            .||:
Human   203 RICE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 11/55 (20%)
CLECT 247..354 CDD:153057 27/123 (22%)
CLEC4ENP_055173.1 CLECT_DC-SIGN_like 80..207 CDD:153060 32/148 (22%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000303|PubMed:24101491 169..171 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.