DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Selp

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_037246.2 Gene:Selp / 25651 RGDID:3656 Length:768 Species:Rattus norvegicus


Alignment Length:131 Identity:38/131 - (29%)
Similarity:63/131 - (48%) Gaps:27/131 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 INHKD-----------AYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDD------KSYWLGI 295
            :|.|:           ||.|.::..||:.....:.||:::.|:    |.|:|      ..||:||
  Rat    34 VNQKEVAAWTYNYSTKAYSWNNSRAFCKRHFTDLVAIQNKNEI----AHLNDVIPYVNSYYWIGI 94

  Fly   296 NDLQSSNTYVSVASGREVEFLNWNAGEPNHGNEDENCVEL-IRS-----KMNDDPCHRKKHVICQ 354
            ..:.:..|:|........|..||...|||:...:::|||: |:|     |.||:||.::|..:|.
  Rat    95 RKINNKWTWVGTNKTLTAEAENWADNEPNNKRNNQDCVEIYIKSNSAPGKWNDEPCFKRKRALCY 159

  Fly   355 T 355
            |
  Rat   160 T 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 36/128 (28%)
SelpNP_037246.2 CLECT_selectins_like 42..160 CDD:153062 35/121 (29%)
EGF_CA <168..195 CDD:238011
CCP 200..258 CDD:153056
PHA02927 276..505 CDD:222943
PHA02927 443..699 CDD:222943
Endocytosis signal. /evidence=ECO:0000305 756..759
Interaction with SNX17. /evidence=ECO:0000250 759..768
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9666
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.