DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Klrd1

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_036877.1 Gene:Klrd1 / 25110 RGDID:2978 Length:179 Species:Rattus norvegicus


Alignment Length:117 Identity:20/117 - (17%)
Similarity:45/117 - (38%) Gaps:23/117 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 YINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYVSVASGR 311
            |...|:...|:.:.:||......:..::.:.||..:|:  ....:|:||:..:..:.::      
  Rat    73 YFISKEEKSWKGSREFCASQNSSLLQLQTRNELSFMSS--SQAFFWIGIHYNEERSAWL------ 129

  Fly   312 EVEFLNWNAGE-------PNHGN-EDENCVEL-IRSKMNDDPCHRKKHVICQ 354
                  |..|.       |.... ..::|:.. |..:::.:.|..|...||:
  Rat   130 ------WEDGTFPSKDLFPEFSKFRQDHCIGYSISREISSESCENKNRFICK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 19/115 (17%)
Klrd1NP_036877.1 CLECT_NK_receptors_like 61..176 CDD:153063 20/117 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5382
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.