DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Sftpa1

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001257574.1 Gene:Sftpa1 / 24773 RGDID:3665 Length:258 Species:Rattus norvegicus


Alignment Length:117 Identity:32/117 - (27%)
Similarity:57/117 - (48%) Gaps:6/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 IGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAIS--ARLDDKSYWLGINDLQSSNT 303
            :|.::|..|.: :.::.:..:.|...||.||..:..||.:||:  |:..:...:||:.:.|:...
  Rat   144 VGDKVFSTNGQ-SVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKKYNNYVYLGMIEDQTPGD 207

  Fly   304 YVSVASGREVEFLNWNAGEPNHGNEDENCVELIR-SKMNDDPCHRKKHVICQ 354
            : ....|..|.:.||..||| .|...|.|||:.. ...||..|.:.:..:|:
  Rat   208 F-HYLDGASVNYTNWYPGEP-RGQGKEKCVEMYTDGTWNDRGCLQYRLAVCE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 29/109 (27%)
Sftpa1NP_001257574.1 Collagen 37..108 CDD:189968
CLECT_collectin_like 146..258 CDD:153061 31/115 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.