DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Klrh1

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_631926.1 Gene:Klrh1 / 246043 RGDID:621452 Length:231 Species:Rattus norvegicus


Alignment Length:128 Identity:29/128 - (22%)
Similarity:53/128 - (41%) Gaps:21/128 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 GSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYV- 305
            |.:.:|.:.::. .|..:...||.:|.::|.|.::||.:.|.:|| :.|||:|:........:| 
  Rat   112 GEKCYYFSEEEK-TWDESEASCRLLGSHLAKIDNREEQNFIQSRL-NYSYWVGLRKKGGQFLWVH 174

  Fly   306 ----SVASGREVEFLNWNAGEPNHGNEDENCVELIRSKMNDDPCHR------KKHVICQTDKE 358
                .::|..:.......|        |..|..:....:|:..|.|      ||:..|....|
  Rat   175 QEDEKISSDLDFHMTTHLA--------DAACGYIKPKLLNNAQCSRLFPYICKKNFTCLLTSE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 26/117 (22%)
Klrh1NP_631926.1 Ly49 36..118 CDD:462461 1/5 (20%)
CLECT_NK_receptors_like 104..220 CDD:153063 25/117 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.