DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec3b

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_035736.2 Gene:Clec3b / 21922 MGIID:104540 Length:202 Species:Mus musculus


Alignment Length:174 Identity:45/174 - (25%)
Similarity:76/174 - (43%) Gaps:28/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 KIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDW 256
            |:.|:.:.::..|.|    |:..|..:|:...|.||.  |||      .:...|.:...|..:: 
Mouse    42 KMFEELKNRMDVLAQ----EVALLKEKQALQTVCLKG--TKV------NLKCLLAFTQPKTFHE- 93

  Fly   257 QSAVDFCRDMGGYIAAIKDQEELDAI--SARL---DDKSYWLGINDLQSSNTYVSVASGREVEFL 316
              |.:.|...||.:...:.:.|.:|:  .||.   :|.:.|||:||:.:...:|.:..|. :.:.
Mouse    94 --ASEDCISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGAWVDMTGGL-LAYK 155

  Fly   317 NWN---AGEPNHGNEDENCVEL---IRSKMNDDPCHRKKHVICQ 354
            ||.   ..:|: |.:.|||..|   ...|..|..|..:...|||
Mouse   156 NWETEITTQPD-GGKAENCAALSGAANGKWFDKRCRDQLPYICQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 10/36 (28%)
CLECT 247..354 CDD:153057 29/117 (25%)
Clec3bNP_035736.2 CLECT_tetranectin_like 71..199 CDD:153066 37/141 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.