DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Selp

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_035477.1 Gene:Selp / 20344 MGIID:98280 Length:768 Species:Mus musculus


Alignment Length:147 Identity:43/147 - (29%)
Similarity:70/147 - (47%) Gaps:31/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 KVFWPKFERIGSRLFYINHKD-----------AYDWQSAVDFCRDMGGYIAAIKDQEELDAISAR 285
            ::.|  |..:.|.|  :|.|:           ||.|.::..|||.....:.||:::.|:    |.
Mouse    22 QLIW--FSALISEL--VNQKEVAAWTYNYSTKAYSWNNSRVFCRRHFTDLVAIQNKNEI----AH 78

  Fly   286 LDD------KSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEPNHGNEDENCVEL-IRS----- 338
            |:|      ..||:||..:.:..|:|........|..||...|||:...:::|||: |:|     
Mouse    79 LNDVIPFFNSYYWIGIRKINNKWTWVGTNKTLTEEAENWADNEPNNKKNNQDCVEIYIKSNSAPG 143

  Fly   339 KMNDDPCHRKKHVICQT 355
            |.||:||.::|..:|.|
Mouse   144 KWNDEPCFKRKRALCYT 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 37/129 (29%)
SelpNP_035477.1 CLECT_selectins_like 42..160 CDD:153062 36/121 (30%)
EGF_CA <168..195 CDD:238011
CCP 200..257 CDD:153056
CCP 262..320 CDD:153056
CCP 324..382 CDD:153056
CCP 386..444 CDD:153056
CCP 448..506 CDD:153056
CCP 510..568 CDD:153056
CCP 580..638 CDD:153056
CCP 642..700 CDD:153056
Endocytosis signal. /evidence=ECO:0000305 756..759
Interaction with SNX17. /evidence=ECO:0000250 759..768
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9758
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.