DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Sell

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_030108191.1 Gene:Sell / 20343 MGIID:98279 Length:387 Species:Mus musculus


Alignment Length:129 Identity:40/129 - (31%)
Similarity:62/129 - (48%) Gaps:20/129 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 FYINH----------KDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKS---YWLGIND 297
            |.|:|          :...:|::|..||:.....:.||:::.|::.:...| .||   ||:||..
Mouse    30 FLIHHGTHCWTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTL-PKSPYYYWIGIRK 93

  Fly   298 LQSSNTYVSVASGREVEFLNWNAGEPNHGNEDENCVELI------RSKMNDDPCHRKKHVICQT 355
            :....|:|........|..||.|||||:....|:|||:.      ..|.|||.||::|..:|.|
Mouse    94 IGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYT 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 37/125 (30%)
SellXP_030108191.1 CLECT_selectins_like 39..157 CDD:153062 36/118 (31%)
EGF_CA 160..192 CDD:238011
CCP 197..255 CDD:153056
CCP 259..317 CDD:153056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.