DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and clec-239

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_507288.2 Gene:clec-239 / 190840 WormBaseID:WBGene00013621 Length:200 Species:Caenorhabditis elegans


Alignment Length:135 Identity:34/135 - (25%)
Similarity:55/135 - (40%) Gaps:28/135 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 WPKFERIGS----RLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAI-----SARLDDKS 290
            |.:|||...    ::|.    ...|..:||..|...|..::.|:||.|.:.|     |...:...
 Worm    55 WEQFERPSGTWCIKVFI----GLGDKANAVSMCAAQGAVVSGIQDQTEREFIVSSYVSLNGNTVG 115

  Fly   291 YWLGINDLQ---SSNTYVSVASGREVEFLN----------WN-AGEPNHGNEDENCVEL-IRSKM 340
            .|||.....   ||....:.:.....|:.:          || |.|||:|:.:|:|:.: .:..|
 Worm   116 VWLGAQRTAACWSSPLTATCSKTTSFEWTDGSATGSDAFIWNVATEPNNGSLNEHCLLMNWQGFM 180

  Fly   341 NDDPC 345
            :|..|
 Worm   181 SDQFC 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 29/119 (24%)
clec-239NP_507288.2 CLECT 65..197 CDD:153057 30/125 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7127
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.