DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Y38H6C.8

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_507951.1 Gene:Y38H6C.8 / 189689 WormBaseID:WBGene00012621 Length:158 Species:Caenorhabditis elegans


Alignment Length:113 Identity:29/113 - (25%)
Similarity:45/113 - (39%) Gaps:23/113 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 WQSAVDFCRDM-GGYIAAIKD-----------QEELDAISARLDDKSYWLGINDLQSSNTYVSVA 308
            ::.|.|.|..| ||.:..|.:           ...|||     |..|:|:|.:|......:..: 
 Worm    39 FKDANDLCVKMFGGSLVKITNIIDNNWMQKLAVNHLDA-----DYNSFWIGASDAAHYTNWTWI- 97

  Fly   309 SGREVEFLNWNAGEPNHGNEDENCVELIRS--KMNDDPCHRKKHVICQ 354
            .|..:.|.||..|:|   .||.:|..::.|  |.....|..:...:||
 Worm    98 DGSPMRFSNWGPGQP---LEDRHCGTMLISTGKWFSQVCDERIQFLCQ 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 27/111 (24%)
Y38H6C.8NP_507951.1 CLECT 18..142 CDD:214480 27/111 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.