DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and clec-149

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_497267.2 Gene:clec-149 / 186903 WormBaseID:WBGene00019328 Length:308 Species:Caenorhabditis elegans


Alignment Length:201 Identity:45/201 - (22%)
Similarity:92/201 - (45%) Gaps:37/201 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 AMPINFEMRLAQIEEQQKLLQETLKKIPE---DFERKLQKLEQNQKDELTKLGAQQSANQVTLKE 228
            |:...|:.:|.:::...:  .||.|.:.:   .||..|::.|                 ::|.|:
 Worm   129 ALEAKFDKKLYEVKMHAQ--YETEKGVGDLRKQFETDLREYE-----------------RITTKD 174

  Fly   229 I--------YTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISAR 285
            |        |.:.  |:........|:|..:::  |.:|.:.|...|.::|:|..:.||..:...
 Worm   175 IVEIKRHLDYLQA--PRITNNDLEYFFIQREES--WYTASEKCIGYGAHLASIHSRLELGFVQRL 235

  Fly   286 LD-DKSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEPNHGNEDENCVELIRS-KMNDDPCHRK 348
            :. :::.|:|:||:|..|.:.: :.|..|:|..|...:|::...:|||||:..| :..|..|...
 Worm   236 VPVNQTAWIGVNDIQKENVFRN-SDGTPVDFYKWGKKQPDNQEHNENCVEVDHSGQWTDKLCIIT 299

  Fly   349 KHVICQ 354
            :..:|:
 Worm   300 RPFVCK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 11/61 (18%)
CLECT 247..354 CDD:153057 28/108 (26%)
clec-149NP_497267.2 CLECT 197..306 CDD:153057 30/112 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4072
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.