Sequence 1: | NP_652641.1 | Gene: | lectin-24Db / 53550 | FlyBaseID: | FBgn0040102 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497267.2 | Gene: | clec-149 / 186903 | WormBaseID: | WBGene00019328 | Length: | 308 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 45/201 - (22%) |
---|---|---|---|
Similarity: | 92/201 - (45%) | Gaps: | 37/201 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 167 AMPINFEMRLAQIEEQQKLLQETLKKIPE---DFERKLQKLEQNQKDELTKLGAQQSANQVTLKE 228
Fly 229 I--------YTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISAR 285
Fly 286 LD-DKSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEPNHGNEDENCVELIRS-KMNDDPCHRK 348
Fly 349 KHVICQ 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-24Db | NP_652641.1 | ExsD | <44..>156 | CDD:293411 | |
NAT_SF | <170..>229 | CDD:302625 | 11/61 (18%) | ||
CLECT | 247..354 | CDD:153057 | 28/108 (26%) | ||
clec-149 | NP_497267.2 | CLECT | 197..306 | CDD:153057 | 30/112 (27%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 54 | 1.000 | Inparanoid score | I4072 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.060 |