DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and clec-28

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001023950.1 Gene:clec-28 / 186005 WormBaseID:WBGene00009857 Length:402 Species:Caenorhabditis elegans


Alignment Length:137 Identity:31/137 - (22%)
Similarity:50/137 - (36%) Gaps:50/137 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 KLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCR 264
            ||..:::|:.|      |.|:.                |...||.||.|  ::..|.|:.::|  
 Worm   159 KLVTVQKNRAD------ADQAC----------------FSLGGSTLFSI--RNDQDNQAVLEF-- 197

  Fly   265 DMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYV---SVASGREVEFLNWNAGEPNHG 326
                    :|||..          ::.|.|:|.: ..|.:.   .|.||....:.|:..|.||  
 Worm   198 --------LKDQHV----------ENLWTGLNCV-GINPFTCTWDVKSGTTSAYNNFADGYPN-- 241

  Fly   327 NEDENCV 333
            |....|:
 Worm   242 NMAGGCI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 6/28 (21%)
CLECT 247..354 CDD:153057 20/90 (22%)
clec-28NP_001023950.1 CLECT 146..274 CDD:214480 31/137 (23%)
CLECT 288..396 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.