DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and clec-148

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_497168.1 Gene:clec-148 / 185558 WormBaseID:WBGene00018246 Length:188 Species:Caenorhabditis elegans


Alignment Length:95 Identity:28/95 - (29%)
Similarity:38/95 - (40%) Gaps:24/95 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 YDWQSAVDF-----------------CRDMGGYIAAIKDQEE------LDAISARLDDKSYWLGI 295
            |.|.|..:|                 ||..|..:|:|....|      |.|...|::.|:.::.|
 Worm    52 YTWFSYTNFCYKSTARAANFNDAHNACRSEGSELASIHSLTENQFLVQLSAAGNRVNSKTNYVMI 116

  Fly   296 NDLQSSNTYVSVASGREVEFLNWNAGEPNH 325
            . |...|...|...|..|.:|||.|||||:
 Worm   117 G-LIFENREWSWTDGSSVNYLNWAAGEPNN 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 28/95 (29%)
clec-148NP_497168.1 CLECT 60..184 CDD:153057 25/87 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.