DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Reg3b

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_035166.1 Gene:Reg3b / 18489 MGIID:97478 Length:175 Species:Mus musculus


Alignment Length:158 Identity:33/158 - (20%)
Similarity:59/158 - (37%) Gaps:30/158 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 QSANQVTLKEI-YTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDM-GGYIAAIKDQEELDA 281
            |...:.:||.| ..::..||..:......|...:....|..|...|:.. ||::.::.:..|...
Mouse    23 QVQGEDSLKNIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASF 87

  Fly   282 ISA--RLDDKSY---WLGIND-----------LQSSNTYVSVASGREVEFLNWNAGEPNHGNEDE 330
            :|:  :....||   |:|::|           .:.||..|       :.:.||.. .|:...:..
Mouse    88 LSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDV-------MNYFNWER-NPSTALDRA 144

  Fly   331 NCVELIRS----KMNDDPCHRKKHVICQ 354
            .|..|.|:    |..|..|..|...:|:
Mouse   145 FCGSLSRASGFLKWRDMTCEVKLPYVCK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 26/127 (20%)
Reg3bNP_035166.1 CLECT_REG-1_like 40..173 CDD:153064 29/141 (21%)
EPN. /evidence=ECO:0000250|UniProtKB:Q06141 114..116 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.