DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and clec-49

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_507829.1 Gene:clec-49 / 180298 WormBaseID:WBGene00012251 Length:321 Species:Caenorhabditis elegans


Alignment Length:73 Identity:21/73 - (28%)
Similarity:40/73 - (54%) Gaps:7/73 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 CRDMGGYIAAIKDQEE---LDAISA----RLDDKSYWLGINDLQSSNTYVSVASGREVEFLNWNA 320
            |..:||::|::::.:|   |.:.:|    |.:...||:|..||::|.|:.........::.||..
 Worm    50 CNLLGGHLASVQNGQENALLQSNAANSFKRSNYSDYWIGATDLETSGTWKWTDPSVTFDYSNWQL 114

  Fly   321 GEPNHGNE 328
            |||..|::
 Worm   115 GEPQSGSD 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 21/73 (29%)
clec-49NP_507829.1 CLECT 31..146 CDD:214480 21/73 (29%)
CLECT 182..315 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.