DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec4d

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_034949.3 Gene:Clec4d / 17474 MGIID:1298389 Length:219 Species:Mus musculus


Alignment Length:131 Identity:36/131 - (27%)
Similarity:57/131 - (43%) Gaps:17/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 VFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDK-SYWLGIN 296
            |.|..|:  .:..|.:|  |...|..:...|..|..::..|..:.|.:.::..||.: ||:||:.
Mouse    85 VSWRAFQ--SNCYFPLN--DNQTWHESERNCSGMSSHLVTINTEAEQNFVTQLLDKRFSYFLGLA 145

  Fly   297 DLQSSNTYVSVASGREVEF----LNWNAGEPNHGNEDENCVELI----RSKMNDDPCHRKKHVIC 353
            |......:..|   .:..|    :.|..||.|...| |:||.|:    :...||.|||.:...||
Mouse   146 DENVEGQWQWV---DKTPFNPHTVFWEKGESNDFME-EDCVVLVHVHEKWVWNDFPCHFEVRRIC 206

  Fly   354 Q 354
            :
Mouse   207 K 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 31/115 (27%)
Clec4dNP_034949.3 CLECT_DC-SIGN_like 83..207 CDD:153060 35/129 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.