DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec10a

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001191181.1 Gene:Clec10a / 17312 MGIID:96975 Length:305 Species:Mus musculus


Alignment Length:254 Identity:57/254 - (22%)
Similarity:105/254 - (41%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LQTTLQESLKKMPAE---LDARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEM 174
            |:.||..:..|:.||   ||:|           .|..|..|:..|...:|..:.|:....::  .
Mouse    69 LRATLDNTTSKIKAEFQSLDSR-----------ADSFEKGISSLKVDVEDHRQELQAGRDLS--Q 120

  Fly   175 RLAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKL-GAQQSANQVTLKEIYTKVFWPKF 238
            ::..:|...:..::.||....|....:|:|.::.|....:| ..:.:.::|....::    |.:.
Mouse   121 KVTSLESTVEKREQALKTDLSDLTDHVQQLRKDLKALTCQLANLKNNGSEVACCPLH----WTEH 181

  Fly   239 ERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNT 303
            |  ||..::...:.:  |..|..:||....::..:...||.:.:..||.:...|:|:.|......
Mouse   182 E--GSCYWFSESEKS--WPEADKYCRLENSHLVVVNSLEEQNFLQNRLANVVSWIGLTDQNGPWR 242

  Fly   304 YVSVASGREVE--FLNWNAGEPN----HG-NEDENCVELIR-SKMNDDPCHRKKHVICQ 354
            :|   .|.:.|  |.||...:|:    || ...|:|..:.. ...|||.|.|....||:
Mouse   243 WV---DGTDFEKGFKNWAPLQPDNWFGHGLGGGEDCAHITTGGPWNDDVCQRTFRWICE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 13/45 (29%)
NAT_SF <170..>229 CDD:302625 9/59 (15%)
CLECT 247..354 CDD:153057 28/114 (25%)
Clec10aNP_001191181.1 Lectin_N 14..164 CDD:281887 23/107 (21%)
CLECT_DC-SIGN_like 174..299 CDD:153060 33/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5478
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.