DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Mbl2

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001351987.1 Gene:Mbl2 / 17195 MGIID:96924 Length:244 Species:Mus musculus


Alignment Length:149 Identity:40/149 - (26%)
Similarity:76/149 - (51%) Gaps:12/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 ELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVD----FCRDMGGYIA 271
            :.:::.::.:|.:..|:.:...|.:...|::|.:.|..:.|     :.::|    .|.:..|.:|
Mouse   100 DT
SEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVK-----KMSLDRVKALCSEFQGSVA 159

  Fly   272 AIKDQEELDAISARLDDKSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEPNHGNEDENCVELI 336
            ..::.||..||.....|.:| |||.|::...::..: :|..|.:.|||.||||:..:.|:||.::
Mouse   160 TPRNAEENSAIQKVAKDIAY-LGITDVRVEGSFEDL-TGNRVRYTNWNDGEPNNTGDGEDCVVIL 222

  Fly   337 -RSKMNDDPCHRKKHVICQ 354
             ..|.||.||......||:
Mouse   223 GNGKWNDVPCSDSFLAICE 241

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 2/17 (12%)
CLECT 247..354 CDD:153057 33/111 (30%)
Mbl2NP_001351987.1 Collagen 36..93 CDD:189968